| 产品详情 |
| Edit |   |
| Antigenic Specificity | FOXO4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FOXO4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FOXO4. This antibody reacts with human. The FOXO4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human FOXO4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG |
| Other Names | AFX, AFX1myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 7, Fork head domain transcription factor AFX1, forkhead box O4, forkhead box protein O4, MLLT7MGC120490, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 7 |
| Gene, Accession # | FOXO4, Gene ID: 4303 |
| Catalog # | NBP2-58083 |
| Price | |
| Order / More Info | FOXO4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|