| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIGU |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIGU Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIGU. This antibody reacts with human. The PIGU Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PIGU antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL |
|---|
| Other Names | bA346K17.2, CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1, CDC91L1CDC91 cell division cycle 91-like 1 (S. cerevisiae), cell division cycle 91-like 1 protein, Cell division cycle protein 91-like 1, GAB1, GPI transamidase component PIG-U, GPI transamidase subunit, MGC40420, phosphatidylinositol glycan anchor biosynthesis class U protein, phosphatidylinositol glycan anchor biosynthesis, class U, Protein CDC91-like 1 |
|---|
| Gene, Accession # | PIGU, Gene ID: 128869, Accession: Q9H490, SwissProt: Q9H490 |
|---|
| Catalog # | NBP2-30691 |
|---|
| Price | |
|---|
| Order / More Info | PIGU Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|