| Edit |   |
|---|
| Antigenic Specificity | SPATA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPATA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA3. This antibody reacts with human. The SPATA3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SPATA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQHSSLETTSRQPAFQALPAPEIRRSSCCLLSPDAN |
|---|
| Other Names | spermatogenesis associated 3, spermatogenesis-associated protein 3, testis and spermatogenesis cell apoptosis related gene 1, Testis spermatocyte apoptosis-related protein 1, TSARG1Testis and spermatogenesis cell-related protein 1 |
|---|
| Gene, Accession # | SPATA3, Gene ID: 130560 |
|---|
| Catalog # | NBP1-80661 |
|---|
| Price | |
|---|
| Order / More Info | SPATA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24309898 |
|---|