| Edit |   |
| Antigenic Specificity | SPATA46 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPATA46 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA46. This antibody reacts with human. The SPATA46 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C1ORF111 The peptide sequence was selected from the middle region of C1ORF111. Peptide sequence CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLRQIGGEAYLCL. |
| Other Names | chromosome 1 open reading frame 111, HSD20, RP11-565P22.3 |
| Gene, Accession # | C1ORF111, Gene ID: 284680 |
| Catalog # | NBP1-70450-20ul |
| Price | |
| Order / More Info | SPATA46 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |