| Edit |   |
|---|
| Antigenic Specificity | SPATA5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPATA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA5. This antibody reacts with human. The SPATA5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SPATA5(spermatogenesis associated 5) The peptide sequence was selected from the middle region of SPATA5. Peptide sequence ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL. |
|---|
| Other Names | AFG2ATPase family gene 2 homolog, ATPase family protein 2 homolog, SPAFspermatogenesis associated factor SPAF, spermatogenesis associated 5, Spermatogenesis-associated factor protein, spermatogenesis-associated protein 5 |
|---|
| Gene, Accession # | SPATA5, Gene ID: 166378, Accession: Q8NB90, SwissProt: Q8NB90 |
|---|
| Catalog # | NBP1-54785-20ul |
|---|
| Price | |
|---|
| Order / More Info | SPATA5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|