| Edit |   |
|---|
| Antigenic Specificity | SPATA9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPATA9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA9. This antibody reacts with human. The SPATA9 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SPATA9(spermatogenesis associated 9) The peptide sequence was selected from the N terminal of SPATA9. Peptide sequence PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK. |
|---|
| Other Names | FLJ35906, NYD-SP16, spermatogenesis associated 9, spermatogenesis-associated protein 9, Testis development protein NYD-SP16 |
|---|
| Gene, Accession # | SPATA9, Gene ID: 83890, Accession: Q9BWV2, SwissProt: Q9BWV2 |
|---|
| Catalog # | NBP1-59460 |
|---|
| Price | |
|---|
| Order / More Info | SPATA9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|