| Edit |   |
| Antigenic Specificity | ABLIM2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended.br> |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABLIM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABLIM2. This antibody reacts with human. The ABLIM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ABLIM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGEDGSLDQDNRKKSSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDPLQRMAGDSFHSRFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDAS |
| Other Names | actin binding LIM protein family, member 2, FLJ26534 |
| Gene, Accession # | ABLIM2, Gene ID: 84448, Accession: Q6H8Q1, SwissProt: Q6H8Q1 |
| Catalog # | NBP1-81370 |
| Price | |
| Order / More Info | ABLIM2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |