| Edit |   |
|---|
| Antigenic Specificity | Apolipoprotein A-II/ApoA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Apolipoprotein A-II/ApoA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Apolipoprotein A-II/ApoA2. This antibody reacts with human. The Apolipoprotein A-II/ApoA2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to APOA2 (apolipoprotein A-II) The peptide sequence was selected from the N terminal of APOA2)(50ug). Peptide sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME. |
|---|
| Other Names | APOA2, apoAII, Apo-AII, ApoA-II, Apolipoprotein A2, apolipoprotein A-II |
|---|
| Gene, Accession # | APOA2, Gene ID: 336, Accession: P02652, SwissProt: P02652 |
|---|
| Catalog # | NBP1-57716 |
|---|
| Price | |
|---|
| Order / More Info | Apolipoprotein A-II/ApoA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|