| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NAA25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NAA25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAA25. This antibody reacts with human. The NAA25 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NAA25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL |
|---|
| Other Names | C12orf30DKFZp667K2112, chromosome 12 open reading frame 30, FLJ13089, MDM20mitochondrial distribution and morphology 20, Mitochondrial distribution and morphology protein 20, N(alpha)-acetyltransferase 25, NatB auxiliary subunit, N-alpha-acetyltransferase 25, NatB auxiliary subunit, NAP1, NatB complex subunit MDM20, N-terminal acetyltransferase B complex subunit MDM20, N-terminal acetyltransferase B complex subunit NAA25, p120 |
|---|
| Gene, Accession # | NAA25, Gene ID: 80018 |
|---|
| Catalog # | NBP1-88391 |
|---|
| Price | |
|---|
| Order / More Info | NAA25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|