| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Lano |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lano Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lano. This antibody reacts with human. The Lano Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESVGALLHLKDLWLDGNQLSELPQEIGNLKNLLCL |
|---|
| Other Names | dJ523E19.1, FLJ10775, FLJ11834, LANOLANO adapter protein, LAP (leucine-rich repeats and PDZ) and no PDZ protein, LAP and no PDZ protein, leucine rich repeat containing 1, leucine-rich repeat-containing 1, leucine-rich repeat-containing protein 1 |
|---|
| Gene, Accession # | LRRC1, Gene ID: 55227 |
|---|
| Catalog # | NBP1-88015 |
|---|
| Price | |
|---|
| Order / More Info | Lano Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|