| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LAPTM5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LAPTM5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LAPTM5. This antibody reacts with human. The LAPTM5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LAPTM5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP |
|---|
| Other Names | CD40-ligand-activated specific transcripts, CLAST6, FLJ61683, FLJ97251, human retinoic acid-inducible E3 protein, KIAA0085, lysosomal associated multispanning membrane protein 5, lysosomal multispanning membrane protein 5, lysosomal protein transmembrane 5, Lysosomal-associated multitransmembrane protein 5, lysosomal-associated transmembrane protein 5, MGC125860, MGC125861, Retinoic acid-inducible E3 protein |
|---|
| Gene, Accession # | LAPTM5, Gene ID: 7805 |
|---|
| Catalog # | NBP2-14183 |
|---|
| Price | |
|---|
| Order / More Info | LAPTM5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|