| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LAPTM4A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LAPTM4A Antibody from Novus Biologicals is a rabbit polyclonal antibody to LAPTM4A. This antibody reacts with human. The LAPTM4A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LAPTM4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVTHPNSMPAVNIQYEVIGNYYSSERMADN |
|---|
| Other Names | Golgi 4-transmembrane-spanning transporter MTP, HUMORF13, KIAA0108MBNT, LAPTM4lysosomal-associated transmembrane protein 4A, lysosomal protein transmembrane 4 alpha, lysosomal-associated protein transmembrane 4 alpha, membrane nucleoside transporter, Mtrp |
|---|
| Gene, Accession # | LAPTM4A, Gene ID: 9741 |
|---|
| Catalog # | NBP1-81646 |
|---|
| Price | |
|---|
| Order / More Info | LAPTM4A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|