| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CEACAM1/CD66a |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEACAM1/CD66a Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEACAM1/CD66a. This antibody reacts with human. The CEACAM1/CD66a Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CEACAM1/CD66a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE |
|---|
| Other Names | antigen CD66, BGP-1, BGP1BGPBiliary glycoprotein 1, BGPI, biliary glycoprotein adhesion molecule, carcinoembryonic antigen-related cell adhesion molecule 1, carcinoembryonic antigen-related cell adhesion molecule 1 (biliaryglycoprotein), CD66a, CD66a antigen |
|---|
| Gene, Accession # | CEACAM1, Gene ID: 634 |
|---|
| Catalog # | NBP1-85743 |
|---|
| Price | |
|---|
| Order / More Info | CEACAM1/CD66a Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|