| Edit |   |
| Antigenic Specificity | DSCC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DSCC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DSCC1. This antibody reacts with human. The DSCC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DSCC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDLCGEKQTIGALLTKYSHSSMQNGVKVYNSRRP |
| Other Names | DCC1MGC5528, defective in sister chromatid cohesion 1 homolog (S. cerevisiae), Defective in sister chromatid cohesion protein 1 homolog, hDCC1, sister chromatid cohesion protein DCC1 |
| Gene, Accession # | DSCC1, Gene ID: 79075, Accession: Q9BVC3, SwissProt: Q9BVC3 |
| Catalog # | NBP2-33275 |
| Price | |
| Order / More Info | DSCC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |