| Edit |   |
| Antigenic Specificity | TMEM209 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM209 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM209. This antibody reacts with human. The TMEM209 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human FLJ14803. Peptide sequence MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK. |
| Other Names | transmembrane protein 209 |
| Gene, Accession # | TMEM209, Gene ID: 84928, Accession: NP_116231, SwissProt: NP_116231 |
| Catalog # | NBP1-91493 |
| Price | |
| Order / More Info | TMEM209 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |