| Edit |   |
| Antigenic Specificity | FAM156A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM156A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM156A. This antibody reacts with human. The FAM156A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human FAM156A. Peptide sequence DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG. |
| Other Names | family with sequence similarity 156, member A, TMEM29 |
| Gene, Accession # | FAM156A, Gene ID: 29057, Accession: NP_054857, SwissProt: NP_054857 |
| Catalog # | NBP1-80458-20ul |
| Price | |
| Order / More Info | FAM156A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |