| Edit |   |
|---|
| Antigenic Specificity | FAM156A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM156A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM156A. This antibody reacts with human. The FAM156A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human FAM156A. Peptide sequence NRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQ. |
|---|
| Other Names | family with sequence similarity 156, member A, TMEM29 |
|---|
| Gene, Accession # | FAM156A, Gene ID: 29057, Accession: NP_054857, SwissProt: NP_054857 |
|---|
| Catalog # | NBP1-80459 |
|---|
| Price | |
|---|
| Order / More Info | FAM156A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|