| Edit |   |
| Antigenic Specificity | FAM161A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM161A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM161A. This antibody reacts with human. The FAM161A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence: RKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEY |
| Other Names | family with sequence similarity 161, member A, RP28 |
| Gene, Accession # | FAM161A, Gene ID: 84140, Accession: NP_115556, SwissProt: NP_115556 |
| Catalog # | NBP1-91508 |
| Price | |
| Order / More Info | FAM161A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |