| Edit |   |
|---|
| Antigenic Specificity | FAM161A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM161A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM161A. This antibody reacts with human. The FAM161A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence: RKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEY |
|---|
| Other Names | family with sequence similarity 161, member A, RP28 |
|---|
| Gene, Accession # | FAM161A, Gene ID: 84140, Accession: NP_115556, SwissProt: NP_115556 |
|---|
| Catalog # | NBP1-91508-20ul |
|---|
| Price | |
|---|
| Order / More Info | FAM161A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|