| Edit |   |
| Antigenic Specificity | FAM168A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM168A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM168A. This antibody reacts with mouse. The FAM168A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Fam168a. Immunizing peptide sequence NSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFR. |
| Other Names | family with sequence similarity 168, member A, hypothetical protein LOC23201, KIAA0280TCRP1Tongue cancer chemotherapy resistance-associated protein 1 |
| Gene, Accession # | FAM168A, Gene ID: 23201, Accession: Q68FE1 |
| Catalog # | NBP1-74067 |
| Price | |
| Order / More Info | FAM168A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |