| Edit |   |
| Antigenic Specificity | FAM171A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM171A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM171A1. This antibody reacts with human. The FAM171A1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human C10orf38. Peptide sequence ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE. |
| Other Names | family with sequence similarity 171, member A1, MGC130014, MGC130015 |
| Gene, Accession # | FAM171A1, Gene ID: 221061, Accession: NP_001010924, SwissProt: NP_001010924 |
| Catalog # | NBP1-91582-20ul |
| Price | |
| Order / More Info | FAM171A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |