| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nuclear Factor Erythroid Derived 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nuclear Factor Erythroid Derived 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nuclear Factor Erythroid Derived 2. This antibody reacts with human. The Nuclear Factor Erythroid Derived 2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NFE2 (nuclear factor (erythroid-derived 2), 45kDa) The peptide sequence was selected from the N terminal of NFE2. Peptide sequence MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP. |
|---|
| Other Names | Leucine zipper protein NF-E2, NF-E2, nuclear factor (erythroid-derived 2), 45kD, nuclear factor (erythroid-derived 2), 45kDa, Nuclear factor, erythroid-derived 2 45 kDa subunit, p45, p45 NF-E2, transcription factor NF-E2 45 kDa subunit |
|---|
| Gene, Accession # | NFE2, Gene ID: 4778, Accession: Q16621, SwissProt: Q16621 |
|---|
| Catalog # | NBP1-69226 |
|---|
| Price | |
|---|
| Order / More Info | Nuclear Factor Erythroid Derived 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|