| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nuclear Factor Erythroid 2 Related Factor 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nuclear Factor Erythroid 2 Related Factor 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nuclear Factor Erythroid 2 Related Factor 1. This antibody reacts with human. The Nuclear Factor Erythroid 2 Related Factor 1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Nuclear Factor Erythroid 2 Related Factor 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDYSHRQKEQDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSL |
|---|
| Other Names | FLJ00380, HBZ17, LCR-F1, Locus control region-factor 1, NF-E2-related factor 1, NFE2-related factor 1, NRF1TCF11, nuclear factor (erythroid-derived 2)-like 1, nuclear factor erythroid 2-related factor 1, Nuclear factor, erythroid derived 2, like 1, TCF-11, Transcription factor 11, transcription factor 11 (basic leucine zipper type), Transcription factor HBZ17, Transcription factor LCR-F1 |
|---|
| Gene, Accession # | NFE2L1, Gene ID: 4779 |
|---|
| Catalog # | NBP2-55915 |
|---|
| Price | |
|---|
| Order / More Info | Nuclear Factor Erythroid 2 Related Factor 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|