| 产品详情 |
| Edit |   |
| Antigenic Specificity | HTRA1/PRSS11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HTRA1/PRSS11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HTRA1/PRSS11. This antibody reacts with human. The HTRA1/PRSS11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HTRA1/PRSS11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA |
| Other Names | ARMD7, EC 3.4.21, EC 3.4.21.108, High-temperature requirement A serine peptidase 1, HtrA serine peptidase 1, L56, ORF480, Serine protease 11, serine, 11 (IGF binding) |
| Gene, Accession # | HTRA1, Gene ID: 5654 |
| Catalog # | NBP1-81654 |
| Price | |
| Order / More Info | HTRA1/PRSS11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 22761798 |
| 产品资料 |
|
|