| Edit |   |
| Antigenic Specificity | CD8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC reported in the literature (PMID: 25541736) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CD8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD8. This antibody reacts with human. The CD8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD8 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
| Other Names | CD8, CD8a molecule, LEU2, p32 |
| Gene, Accession # | CD8A, Gene ID: 925, Accession: P01732, SwissProt: P01732 |
| Catalog # | NBP2-34039 |
| Price | |
| Order / More Info | CD8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25541736 |