| Edit |   |
|---|
| Antigenic Specificity | VGLUT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VGLUT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VGLUT1. This antibody reacts with human. The VGLUT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VGLUT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSISEEERKYIEDAIGESAKLMNPLTKFSTP |
|---|
| Other Names | BNPIbrain-specific Na-dependent inorganic phosphate cotransporter, Brain-specific Na(+)-dependent inorganic phosphate cotransporter, member 7, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), Solute carrier family 17 member 7, VGluT1, VGLUT1vesicular glutamate transporter 1 |
|---|
| Gene, Accession # | SLC17A7, Gene ID: 57030, Accession: Q9P2U7, SwissProt: Q9P2U7 |
|---|
| Catalog # | NBP2-39000 |
|---|
| Price | |
|---|
| Order / More Info | VGLUT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|