| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VGLUT1 |
|---|
| Clone | 2754 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2b |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VGLUT1 Antibody (2754) from Novus Biologicals is a mouse monoclonal antibody to VGLUT1. This antibody reacts with human, mouse, rat. The VGLUT1 Antibody (2754) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VGLUT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PSISEEERKYIEDAIGESAKLMNPLTKFSTP |
|---|
| Other Names | BNPIbrain-specific Na-dependent inorganic phosphate cotransporter, Brain-specific Na(+)-dependent inorganic phosphate cotransporter, member 7, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), Solute carrier family 17 member 7, VGluT1, VGLUT1vesicular glutamate transporter 1 |
|---|
| Gene, Accession # | SLC17A7, Gene ID: 57030, Accession: Q9P2U7 |
|---|
| Catalog # | NBP2-46627 |
|---|
| Price | |
|---|
| Order / More Info | VGLUT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|