| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | YIF1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The YIF1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to YIF1A. This antibody reacts with human, mouse, rat. The YIF1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat YIF1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ |
|---|
| Other Names | 54TMp, 54TMYIF1protein YIF1A, FinGER7, HYIF1P, putative Rab5-interacting protein, putative transmembrane protein 54TMp, YIF1P, Yip1 interacting factor homolog (S. cerevisiae), Yip1 interacting factor homolog A (S. cerevisiae), YIP1-interacting factor homolog A, Yip1p-interacting factor |
|---|
| Gene, Accession # | YIF1A, Gene ID: 10897, Accession: O95070, SwissProt: O95070 |
|---|
| Catalog # | NBP1-89362 |
|---|
| Price | |
|---|
| Order / More Info | YIF1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|