| Edit |   |
|---|
| Antigenic Specificity | YIPF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The YIPF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to YIPF1. This antibody reacts with human. The YIPF1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to YIPF1(Yip1 domain family, member 1) The peptide sequence was selected from the middle region of YIPF1. Peptide sequence HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVS. |
|---|
| Other Names | Yip1 domain family, member 1 |
|---|
| Gene, Accession # | YIPF1, Gene ID: 54432 |
|---|
| Catalog # | NBP1-70750 |
|---|
| Price | |
|---|
| Order / More Info | YIPF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|