| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | YIPF3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The YIPF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to YIPF3. This antibody reacts with human. The YIPF3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human YIPF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM |
|---|
| Other Names | C6orf109, chromosome 6 open reading frame 109, dJ337H4.3, FinGER3, Killer lineage protein 1, KLIP1DKFZp566C243, Natural killer cell-specific antigen KLIP1, protein YIPF3, Yip1 domain family, member 3, YIP1 family member 3 |
|---|
| Gene, Accession # | YIPF3, Gene ID: 25844 |
|---|
| Catalog # | NBP2-56181 |
|---|
| Price | |
|---|
| Order / More Info | YIPF3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|