| Edit |   |
|---|
| Antigenic Specificity | MAGP-1/MFAP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAGP-1/MFAP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAGP-1/MFAP2. This antibody reacts with human. The MAGP-1/MFAP2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MFAP2(microfibrillar-associated protein 2) The peptide sequence was selected from the N terminal of MFAP2 (NP_059453). Peptide sequence MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY. |
|---|
| Other Names | MAGP1, MAGP-1FLJ50901, MAGPMFAP-2, Microfibril-associated glycoprotein 1, microfibrillar-associated protein 2 |
|---|
| Gene, Accession # | MFAP2, Gene ID: 4237, Accession: P55001, SwissProt: P55001 |
|---|
| Catalog # | NBP1-58019 |
|---|
| Price | |
|---|
| Order / More Info | MAGP-1/MFAP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24353434 |
|---|