| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAG/Siglec-4a |
|---|
| Clone | 3C7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAG/Siglec-4a Antibody (3C7) from Novus Biologicals is a mouse monoclonal antibody to MAG/Siglec-4a. This antibody reacts with human. The MAG/Siglec-4a Antibody (3C7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | MAG (NP_002352 119 a.a. - 208 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR |
|---|
| Other Names | GMAsialic acid binding Ig-like lectin 4A, myelin associated glycoprotein, myelin-associated glycoprotein, sialic acid-binding immunoglobulin-like lectin 4A, SIGLEC4A, SIGLEC-4A, S-MAG |
|---|
| Gene, Accession # | MAG, Gene ID: 4099, Accession: NP_002352, SwissProt: NP_002352 |
|---|
| Catalog # | H00004099-M35 |
|---|
| Price | |
|---|
| Order / More Info | MAG/Siglec-4a Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|