| Edit |   |
|---|
| Antigenic Specificity | MAIP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAIP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAIP1. This antibody reacts with human. The MAIP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C2ORF47 The peptide sequence was selected from the middle region of C2ORF47. Peptide sequence GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE. |
|---|
| Other Names | chromosome 2 open reading frame 47, DKFZp666A212, FLJ22555, hypothetical protein LOC79568 |
|---|
| Gene, Accession # | C2ORF47, Gene ID: 79568, Accession: Q8WWC4, SwissProt: Q8WWC4 |
|---|
| Catalog # | NBP1-57840 |
|---|
| Price | |
|---|
| Order / More Info | MAIP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|