| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HIP1 Related |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIP1 Related Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIP1 Related. This antibody reacts with human. The HIP1 Related Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HIP1 Related antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR |
|---|
| Other Names | FLJ14000, HIP-12, HIP12HIP1-related protein, HIP3, huntingtin interacting protein 1 related, huntingtin interacting protein 12, Huntingtin-interacting protein 12, huntingtin-interacting protein 1-related protein, ILWEQ, KIAA0655FLJ27022, MGC47513 |
|---|
| Gene, Accession # | HIP1R, Gene ID: 9026, Accession: O75146, SwissProt: O75146 |
|---|
| Catalog # | NBP2-38390 |
|---|
| Price | |
|---|
| Order / More Info | HIP1 Related Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|