| Edit |   |
|---|
| Antigenic Specificity | HIRA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIRA Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIRA. This antibody reacts with human. The HIRA Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HIRA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTG |
|---|
| Other Names | DGCR1DiGeorge critical region gene 1, HIR, HIR (histone cell cycle regulation defective) homolog A (S. cerevisiae), HIR histone cell cycle regulation defective homolog A (S. cerevisiae), TUP1, TUP1-like enhancer of split protein 1, TUPLE1protein HIRA |
|---|
| Gene, Accession # | HIRA, Gene ID: 7290 |
|---|
| Catalog # | NBP2-55647 |
|---|
| Price | |
|---|
| Order / More Info | HIRA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|