| Edit |   |
|---|
| Antigenic Specificity | HIRIP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIRIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIRIP3. This antibody reacts with human. The HIRIP3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HIRIP3(HIRA interacting protein 3) The peptide sequence was selected from the middle region of HIRIP3. Peptide sequence RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK. |
|---|
| Other Names | HIRA interacting protein 3, HIRA-interacting protein 3 |
|---|
| Gene, Accession # | HIRIP3, Gene ID: 8479, Accession: Q9BW71, SwissProt: Q9BW71 |
|---|
| Catalog # | NBP1-53074-20ul |
|---|
| Price | |
|---|
| Order / More Info | HIRIP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|