| Edit |   |
|---|
| Antigenic Specificity | PEX11B |
|---|
| Clone | 2D2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunohistochemistry-Paraffin. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PEX11B Antibody (2D2) from Novus Biologicals is a mouse monoclonal antibody to PEX11B. This antibody reacts with human. The PEX11B Antibody (2D2) has been validated for the following applications: ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PEX11B (NP_003837.1, 1 a.a. - 98 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFA |
|---|
| Other Names | peroxin-11B, peroxisomal biogenesis factor 11 beta, Peroxisomal biogenesis factor 11Bperoxisomal membrane protein 11B, PEX11-beta, Protein PEX11 homolog beta |
|---|
| Gene, Accession # | PEX11B, Gene ID: 8799, Accession: NP_003837, SwissProt: NP_003837 |
|---|
| Catalog # | H00008799-M03 |
|---|
| Price | |
|---|
| Order / More Info | PEX11B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|