| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VENTX |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VENTX Antibody from Novus Biologicals is a rabbit polyclonal antibody to VENTX. This antibody reacts with human. The VENTX Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VENTX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL |
|---|
| Other Names | homeobox protein VENTX, HPX42BNA88A, MGC119910, MGC119911, VENT homeobox homolog, VENT homeobox homolog (Xenopus laevis), VENT-like homeobox 2, VENT-like homeobox protein 2, VENTX2hemopoietic progenitor homeobox protein VENTX2 |
|---|
| Gene, Accession # | VENTX, Gene ID: 27287, Accession: O95231, SwissProt: O95231 |
|---|
| Catalog # | NBP2-30751 |
|---|
| Price | |
|---|
| Order / More Info | VENTX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|