| Edit |   |
|---|
| Antigenic Specificity | SPNS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPNS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPNS2. This antibody reacts with human. The SPNS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SPNS2(spinster homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of SPNS2 (NP_001118230). Peptide sequence PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY. |
|---|
| Other Names | protein spinster homolog 2, spinster homolog 2 (Drosophila) |
|---|
| Gene, Accession # | SPNS2, Gene ID: 124976, Accession: Q8IVW8, SwissProt: Q8IVW8 |
|---|
| Catalog # | NBP1-54345 |
|---|
| Price | |
|---|
| Order / More Info | SPNS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|