| Edit |   |
|---|
| Antigenic Specificity | SPOP |
|---|
| Clone | 3E2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPOP Antibody (3E2) from Novus Biologicals is a mouse monoclonal antibody to SPOP. This antibody reacts with human. The SPOP Antibody (3E2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SPOP (NP_001007227.1 301 a.a. - 374 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS |
|---|
| Other Names | HIB homolog 1, Roadkill homolog 1, speckle-type POZ protein, TEF2 |
|---|
| Gene, Accession # | SPOP, Gene ID: 8405, Accession: NP_001007227, SwissProt: NP_001007227 |
|---|
| Catalog # | H00008405-M04 |
|---|
| Price | |
|---|
| Order / More Info | SPOP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|