| Edit |   |
|---|
| Antigenic Specificity | SPOPL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPOPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPOPL. This antibody reacts with human. The SPOPL Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human SPOPLThe immunogen for this antibody is SPOPL. Peptide sequence WNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQ. |
|---|
| Other Names | FLJ53775, HIB homolog 2, Roadkill homolog 2, speckle-type POZ protein-like |
|---|
| Gene, Accession # | SPOPL, Gene ID: 339745, Accession: NP_001001664, SwissProt: NP_001001664 |
|---|
| Catalog # | NBP1-79345-20ul |
|---|
| Price | |
|---|
| Order / More Info | SPOPL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|