| Edit |   |
| Antigenic Specificity | SPOPL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPOPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPOPL. This antibody reacts with human. The SPOPL Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human SPOPLThe immunogen for this antibody is SPOPL. Peptide sequence WNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQ. |
| Other Names | FLJ53775, HIB homolog 2, Roadkill homolog 2, speckle-type POZ protein-like |
| Gene, Accession # | SPOPL, Gene ID: 339745, Accession: NP_001001664, SwissProt: NP_001001664 |
| Catalog # | NBP1-79345 |
| Price | |
| Order / More Info | SPOPL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |