| 产品详情 |
| Edit |   |
| Antigenic Specificity | SPPL2a |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPPL2a Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPPL2a. This antibody reacts with human. The SPPL2a Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SPPL2a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE |
| Other Names | EC 3.4.23, EC 3.4.23.-, IMP-3, IMP3intramembrane cleaving protease, Intramembrane protease 3, Presenilin-like protein 2, PSL2, signal peptide peptidase-like 2A, SPPL2a, SPP-like 2A |
| Gene, Accession # | SPPL2A, Gene ID: 84888 |
| Catalog # | NBP1-87512 |
| Price | |
| Order / More Info | SPPL2a Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|