| 产品详情 |
| Edit |   |
| Antigenic Specificity | STK39 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STK39 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STK39. This antibody reacts with human. The STK39 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human STK39 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ |
| Other Names | DCHTsmall intestine SPAK-like kinase, DKFZp686K05124, EC 2.7.11, EC 2.7.11.1, PASK, proline-alanine-rich STE20-related kinase, serine threonine kinase 39, Serine/threonine-protein kinase 39, SPAKserine threonine kinase 39 (STE20/SPS1 homolog, yeast), STE20/SPS1 homolog, STE20/SPS1-related proline-alanine-rich protein kinase, Ste20-like protein kinase, Ste-20-related kinase |
| Gene, Accession # | STK39, Gene ID: 27347 |
| Catalog # | NBP2-49373 |
| Price | |
| Order / More Info | STK39 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|