| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STK4 |
|---|
| Clone | 4F4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Proximity Ligation Assay. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STK4 Antibody (4F4) from Novus Biologicals is a mouse monoclonal antibody to STK4. This antibody reacts with human, mouse, rat. The STK4 Antibody (4F4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Proximity Ligation Assay. |
|---|
| Immunogen | STK4 (NP_006273 391 a.a. - 485 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, kinase responsive to stress 2, KRS2KRS2)), Mammalian STE20-like protein kinase 1, mammalian sterile 20-like 1, MST-1, MST1DKFZp686A2068, serine/threonine kinase 4, serine/threonine-protein kinase 4, Serine/threonine-protein kinase Krs-2, STE20-like kinase MST1 |
|---|
| Gene, Accession # | STK4, Gene ID: 6789, Accession: NP_006273, SwissProt: NP_006273 |
|---|
| Catalog # | H00006789-M02 |
|---|
| Price | |
|---|
| Order / More Info | STK4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|