| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STK4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STK4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STK4. This antibody reacts with human, mouse, rat. The STK4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat STK4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, kinase responsive to stress 2, KRS2KRS2)), Mammalian STE20-like protein kinase 1, mammalian sterile 20-like 1, MST-1, MST1DKFZp686A2068, serine/threonine kinase 4, serine/threonine-protein kinase 4, Serine/threonine-protein kinase Krs-2, STE20-like kinase MST1 |
|---|
| Gene, Accession # | STK4, Gene ID: 6789 |
|---|
| Catalog # | NBP1-82865 |
|---|
| Price | |
|---|
| Order / More Info | STK4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21228115 |
|---|
| 产品资料 |
|
|