| 产品详情 |
| Edit |   |
| Antigenic Specificity | STK4 |
| Clone | 1D7-8A10 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STK4 Antibody (1D7-8A10) from Novus Biologicals is a mouse monoclonal antibody to STK4. This antibody reacts with human. The STK4 Antibody (1D7-8A10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | STK4 (AAH05231, 1 a.a. - 39 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG |
| Other Names | EC 2.7.11, EC 2.7.11.1, kinase responsive to stress 2, KRS2KRS2)), Mammalian STE20-like protein kinase 1, mammalian sterile 20-like 1, MST-1, MST1DKFZp686A2068, serine/threonine kinase 4, serine/threonine-protein kinase 4, Serine/threonine-protein kinase Krs-2, STE20-like kinase MST1 |
| Gene, Accession # | STK4, Gene ID: 6789, Accession: AAH05231, SwissProt: AAH05231 |
| Catalog # | H00006789-M01 |
| Price | |
| Order / More Info | STK4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28487119 |
| 产品资料 |
|
|