| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STK22C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STK22C Antibody from Novus Biologicals is a rabbit polyclonal antibody to STK22C. This antibody reacts with human. The STK22C Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human STK22C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMV |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 22C (spermiogenesis associated), Serine/threonine-protein kinase 22C, SPOGA3TSK3, STK22Cspermiogenesis associated 3, STK22D, Testis-specific kinase 3, testis-specific serine kinase 3, testis-specific serine/threonine kinase 22C, testis-specific serine/threonine-protein kinase 3, TSK-3, TSSK-3 |
|---|
| Gene, Accession # | TSSK3, Gene ID: 81629 |
|---|
| Catalog # | NBP2-48674 |
|---|
| Price | |
|---|
| Order / More Info | STK22C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|