| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STK11IP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STK11IP Antibody from Novus Biologicals is a rabbit polyclonal antibody to STK11IP. This antibody reacts with human. The STK11IP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human STK11IP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPTLQQLNHVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHC |
|---|
| Other Names | KIAA1898LKB1 interacting protein, LIP1serine/threonine kinase 11-interacting protein, LKB1-interacting protein 1, LKB1IPserine/threonine-protein kinase 11-interacting protein, serine/threonine kinase 11 interacting protein, STK11IP1STK11 interacting protein |
|---|
| Gene, Accession # | STK11IP, Gene ID: 114790 |
|---|
| Catalog # | NBP1-92451 |
|---|
| Price | |
|---|
| Order / More Info | STK11IP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|