| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Calreticulin-2/CALR3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calreticulin-2/CALR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Calreticulin-2/CALR3. This antibody reacts with human. The Calreticulin-2/CALR3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Calreticulin-2/CALR3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRN |
|---|
| Other Names | calreticulin 2, calreticulin 3, Calreticulin-2, calreticulin-3, cancer/testis antigen 93, CRT2calreticulin-2, CT93, FLJ25355, MGC26577 |
|---|
| Gene, Accession # | CALR3, Gene ID: 125972, Accession: Q96L12, SwissProt: Q96L12 |
|---|
| Catalog # | NBP2-33390 |
|---|
| Price | |
|---|
| Order / More Info | Calreticulin-2/CALR3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|